🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280!
🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280!
Add friend
Neurturin, Human

Neurturin, Human

Neurturin, Human

Add to cart

Neurturin (NRTN) is a protein which belongs to the glial cell-line derived neurotrophic factor (GDNF) family of neurotrophic factors, regulate the survival and function of neurons. Neurturin had been shown to promote the survival of a variety of neurons including sympathetic, sensory, and central nervous system neurons. Neurturin is expressed in both neuronal and non-neuronal tissues. It may play a role in regulating the development and maintenance of the central and peripheral nervous systems and as well as non-neuronal systems.

Sequence: 
MARLGARPCGLRELEVRVSELGLGYASDETVLFRYCAGACEAAARVYDLGLRRLRQRRRLRRERVRAQPCCRPTAYEDEVSFLDAHSRYHTV
HELSARECACV with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method. Activity:
Measure by its ability to induce proliferation in SH-SY5Y cells. The ED50 for this effect is <50 ng/mL. Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.