Midkine, Human

Midkine, Human

Midkine, Human

Add to cart

Product Description

Midkine (MK or MDK) also known as neurite growth-promoting factor 2 (NEGF2) is a protein that in humans is encoded by the MDK gene. It promotes angiogenesis, cell growth, and cell migration. Midkine is also expressed in several carcinomas, suggesting that it may play a role in tumorigenesis, perhaps through its effects on angiogenesis. Midkine exhibited increased expression in the breast carcinomas but showed much lower expression in the normal breast tissue.

KKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD with polyhistidine tag at the C-terminus

Escherichia coli

Endotoxin Test:
<0.01 EU per 1 μg of the protein by the LAL method. Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.

It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Please use within one month after protein reconstitution.