Midkine (MK or MDK) also known as neurite growth-promoting factor 2 (NEGF2) is a protein that in humans is encoded by the MDK gene. It promotes angiogenesis, cell growth, and cell migration. Midkine is also expressed in several carcinomas, suggesting that it may play a role in tumorigenesis, perhaps through its effects on angiogenesis. Midkine exhibited increased expression in the breast carcinomas but showed much lower expression in the normal breast tissue.
Sequence:Â
MVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTL
KKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD with polyhistidine tag at the C-terminus
Source:
Escherichia coli
Endotoxin Test:
<0.01 EU per 1 μg of the protein by the LAL method.
Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography
Formulation:
The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Note:
Please use within one month after protein reconstitution.



