IL-13, Mouse
Add to cart
Interleukin 13 (IL-13) is a protein that in humans is encoded by the IL13 gene. IL-13 was first cloned in 1993 and is located on chromosome 5q31 with a length of 1.4kb. It has a mass of 13 kDa and folds into 4 alpha helical bundles. The secondary structural features of IL-13 are similar to that of Interleukin 4 (IL-4); however it only has 25% sequence homology to IL-4 and is capable of IL-4 independent signaling. IL-13 is a cytokine secreted by T helper type 2 (Th2) cells, CD4 cells, Natural killer T cell, Mast cell, Basophil cells, Eosinophil cells and Nuocyte cells. Interleukin-13 is a central regulator in IgE synthesis, goblet cell hyperplasia, mucus hypersecretion, airway hyperresponsiveness, fibrosis and chitinase up-regulation. It is a mediator of allergic inflammation and different diseases including asthma.
Sequence:
MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFI
TKLLSYTKQLFRHGPF with polyhistidine tag at the C-terminusSource:
Escherichia coliEndotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method. Activity:
Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <4 ng/mL. The specific activity of recombinant mouse IL-13 is > 2.5 x 105 IU/mg.
MPVPRSVSLPLTLKELIEELSNITQDQTPLCNGSMVWSVDLAAGGFCVALDSLTNISNCNAIYRTQRILHGLCNRKAPTTVSSLPDTKIEVAHFI
TKLLSYTKQLFRHGPF with polyhistidine tag at the C-terminusSource:
Escherichia coliEndotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method. Activity:
Measure by its ability to induce TF-1 cells proliferation. The ED50 for this effect is <4 ng/mL. The specific activity of recombinant mouse IL-13 is > 2.5 x 105 IU/mg.
Purity:
>95% as determined by SDS-PAGE. Ni-NTA chromatography
Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Note:
Please use within two weeks after protein reconstitution.
HOW CAN WE HELP YOU? Our specialists are to help you find the best product for your application. We will be happy to help you find the right product for the job.
TALK TO A SPECIALIST
Contact our Customer Care, Sales & Scientific Assistance
EMAIL US
Consult and asked questions about our products & services
DOCUMENTATION
Documentation of Technical & Safety Data Sheet, Guides and more..
NEWSLETTER
We gladly support you by keeping you updated on our latest products and the developments around our services.
ATLANTIS BIOSCIENCE PTE LTD
362 Upper Paya Lebar Rd, #07-15,
Singapore 534963
WeChat ID: +65 8608 0974
© 2015-2023 Atlantis Bioscience Pte Ltd. All rights reserved. Co Reg No: 201539516N