🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280!
🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280!
Add friend
Galectin-9, Human

Galectin-9, Human

Galectin-9, Human

Add to cart

Galectin-9 is belonging to the lectin family, that containing total 15 mammalian lectin members. Similar to other galectins, There is a carbohydrate recognition binding domain that enables Galectin-9 binding to β-galactosides specifically. Most galectins are either bivalent or multivalent regarding their carbohydrate binding capacity, which enables the recognition of distinct signaling pathways. Galectin-9 may be retained intracellularly or transported to the cell surface where it can be cleaved to generate a soluble form. Galectin-9 functions in effector and regulatory phases of the immune response. During inflammation, the production of Galectin-9 in vivo generates a microenvironment that limits effector T cell responses. Galectin-9 can negatively regulate the Th1 immune response by engaging TIM-3 on T cells, which leads to induction of intracellular Ca2+ influx and activation of apoptosis pathways.

Sequence:
AFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMP
FQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPP
MMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSF
SVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT with polyhistidine tag at the N-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method. Activity: Measured by its ability of the immobilized protein to support the adhesion of Jurkat cells. The ED50 for this effect is <3 μg/mL. Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.