🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280!
🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280!
Add friend
Galectin-7, Human

Galectin-7, Human

Galectin-7, Human

Add to cart

The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. Galectin-7 is a protein that in humans is encoded by the LGALS7 gene. It is expressed at all stages of epidermal differentiation (i.e., in basal and suprabasal layers). The protein was found mainly in stratified squamous epithelium. The cellular localization and its striking down-regulation in cultured keratinocytes imply a role in cell-cell and/or cell–matrix interactions necessary for normal growth control.

Sequence:
SNVPHKSSLPEGIRPGTVLRIRGLVPPNASRFHVNLLCGEEQGSDAALHFNPRLDTSEVVFNSKEQGSWGREERGPGVPFQRGQPFEVLIIAS
DDGFKAVVGDAQYHHFRHRLPLARVRLVEVGGDVQLDSVRIF with polyhistidine tag at the Nterminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method. Activity: Measured by its ability to agglutinate human red blood cells. The ED50 for this effect is <2 μg/mL. Purity: >98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.