Product Description
FGF-20 is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. FGF-20 signals through FGFR 2c and 3c, and is expressed during limb and brain development. Recombinant Human FGF-20 is a 23.2 kDa protein containing 209 amino acid residues.
Sequence:
MPLAEVGGFLGGLEGLGQQVGSHFLLPPAGERPPLLGERRSAAERSARGGPGAAQLAHLHGILRRRQLYCRTGFHLQILPDGSVQGTRQDHS
LFGILEFISVAVGLVSIRGVDSGLYLGMNDKGELYGSEKLTSECIFREQFEENWYNTYSSNIYKHGDTGRRYFVALNKDGTPRDGARSKRHQKF
THFLPRPVDPERVPELYKDLLMYT with polyhistidine tag at the C-terminus
Source:
Escherichia coli
Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.
Activity:
Measure by its ability to induce 3T3 cells proliferation. The ED50 for this effect is 1.3-3.2 ng/mL. The specific activity of recombinant human FGF-20 is > 2 x 105 IU/mg.
Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography
Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Note:
Please use within one month after protein reconstitution.