CDNF (Cerebral dopamine neurotrophic factor), Human

CDNF (Cerebral dopamine neurotrophic factor), Human

CDNF (Cerebral dopamine neurotrophic factor), Human

Add to cart
Description

Product Description

Cerebral dopamine neurotrophic factor also known as ARMET-like protein 1 or is a protein that in humans that is encoded by the CDNF gene. CDNF protein is expressed in human brain, acts differently from known neurotrophic factors and can protect and repair dopamine neurons in two pre-clinical models of Parkinson’s disease (PD).

Sequence: 
MQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKL
DSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method. Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.