🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280!
🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280!
Add friend
CD40L, Human

CD40L, Human

CD40L, Human

Add to cart
Description

Product Description

CD40, belonging to the TNF receptor family, is a cell surface protein generally expressed on B cells, dendritic cells, monocytes, thymic epithelial cells and on T cells at low levels. The membrane-anchored CD40 Ligand is expressed almost exclusively on activated CD4+ T lymphocytes. CD40 signaling plays a significant role immunoglobulin (Ig) class switching, and is critical for the proliferation and differentiation of B cells. A disease “immunodeficiency with hyper-IgM”, characterized by failure to produce IgG, IgA and IgE due to failure expression of CD40L. The soluble form of CD40L is produced in vivo by an intracellular proteolytic processing of the entire TNF homologous region (18 kDa protein) of CD40L.

Sequence: 
MQKGDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQVTFCSNREASSQAPFIASLWLKSPGRFERIL
LRAANTHSSAKPCGQQSIHLGGVFELQPGASVFVNVTDPSQVSHGTGFTSFGLLKL with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method. Activity:
Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is <5 ng/mL. Purity:
>95% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.