BMP-2 like other bone morphogenetic proteins, plays an important role in the development of bone and cartilage. It is involved in the hedgehog pathway, TGF beta signaling pathway, and in cytokine-cytokine receptor interaction. It is also involved in cardiac cell differentiation and epithelial to mesenchymal transition. Like many other proteins from the BMP family, BMP-2 has been demonstrated to potently induce osteoblast differentiation in a variety of cell types. BMP-2 may be involved in white adipogenesis and may have metabolic effects
Sequence:
MQAKHKQRKRLKSSCKRHPLYVDFSDVGWNDWIVAPPGYHAFYCHGECPFPLADHLNSTNHAIVQTLVNVNSKIPKACCVPTELSAISMLY
LDENEKVVLKNYQDMVVEGCGCR with polyhistidine tag at the C-terminus
Source:
Escherichia coli
Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.
Activity:
Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <9.5 ng/mL.
The specific activity of recombinant BMP-2 is > 3.2 x 106 IU/mg.
Purity:
>95% as determined by SDS-PAGE. Ni-NTA chromatography
Formulation:
The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Note:
Please use within one month after protein reconstitution.