BMPs (bone morphogenetic proteins) belong to the TGF-beta superfamily of structurally related signaling proteins. BMP-11 is a regulator of cell growth and differentiation during muscular and neural development. BMP-11 binds the transforming growth factor-beta receptors ALK4, ALK5, and ALK7 to activate SMAD signaling. In adults, exogenous BMP-11 promotes cardiomyocyte regeneration to reverse age-related cardiac hypertrophy.
Sequence:
MNLGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLVQQANPRGSAGPCCTPTKMSPINMLYFN
DKQQIIYGKIPGMVVDRCGCS with polyhistidine tag at the C-terminus
Source:
Escherichia coli
Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method.
Activity:
Measure by its ability to induce alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <11 ng/mL.
Measure by its ability to induce hemoglobin expression in K562 cells. The ED50 for this effect is <4 ng/mL.
Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography
Formulation:
The protein was lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.
Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.
Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.
Note:
Please use within one month after protein reconstitution.



