🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280!
🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280!
Add friend
IL-37, Human

IL-37, Human

IL-37, Human

Add to cart

Decreasing synthesis of IL-37 in PBMCs will cause increasing production of pro-inflammatory cytokines such as IL-1 alpha, IL-1 beta, IL-6 and TNF- alpha. The IL-37 work as an innate inflammatory inhibitor is also proved by its high expression in synovial tissue from rheumatoid arthritis patients. Full length IL-37 locates mainly in the cytoplasm, and it can translocate to the nucleus after activation through cleavage by CASP1, then exerts its activity by directly interacting with SMAD3.

Sequence: 
MKNLNPKKFSIHDQDHKVLVLDSGNLIAVPDKNYIRPEIFFALASSLSSASAEKGSPILLGVSKGEFCLYCDKDKGQSHPSLQLKKEKLMKLAA
QKESARRPFIFYRAQVGSWNMLESAAHPGWFICTSCNCNEPVGVTDKFENRKHIEFSFQPVCKAEMSPSEVSD with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method. Activity:
Measure by its ability to induce IL-8 secretion in human PBMCs. The ED50 for this effect is <0.9 μg/mL. Purity:
>95% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 8.0.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.