Add friend
Noggin, Human

Noggin, Human

Noggin, Human

Add to cart

Noggin is a bioactive protein intended for use in cell culture applications. Noggin protein which bind to ligands of the TGF-β family and regulate their activity by inhibiting their access to signaling receptors. Noggin was originally identified as a BMP-4 antagonist whose action is critical for proper formation of the head and other dorsal structures.

Sequence:
MQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPS
EIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQ
RRGGQRCGWIPIQYPIISECKCSC with polyhistidine tag at the C-terminus

Source:
Escherichia coli

Endotoxin level:
<0.1 EU per 1 μg of the protein by the LAL method. Activity:
Measure by its ability to inhibit BMP-4-induced alkaline phosphatase production by ATDC5 cells. The ED50 for this effect is <0.05 μg/mL in the presence of 50 ng/mL of recombinant human BMP-4. Purity:
>98% as determined by SDS-PAGE.

Formulation:
The protein was lyophilized from a solution containing 1X PBS containing, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage: 
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.