🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280!
🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280! 🔥 Don’t Miss Out on our Blind Box Giveaway with a minimum spend of $280!
Add friend
IL-17B, Mouse

IL-17B, Mouse

IL-17B, Mouse

Add to cart

The interleukin (IL)-17 superfamily, a relatively new family of cytokines, consists of six ligands (from IL-17A to IL-17F), which bind to five receptor subtypes (from IL-17RA to IL-17RE) and induce downstream signaling. L17B Diseases associated with IL17B include spondyloarthropathy and neuronitis, and among its related super-pathways are Mucin expression in CF via IL-6, IL-17 signaling pathways, and STAT3 Pathway.

Sequence: 
MHPRNTKGKRKGQGRPSPLAPGPHQVPLDLVSRVKPYARMEEYERNLGEMVAQLRNSSEPAKKKCEVNLQLWLSNKRSLSPWGYSINHD
PSRIPADLPEARCLCLGCVNPFTMQEDRSMVSVPVFSQVPVRRRLCPQPPRPGPCRQRVVMETIAVGCTCIF with polyhistidine tag at the C-terminusSource:
Escherichia coli

Endotoxin Test:
<0.1 EU per 1 μg of the protein by the LAL method. Activity:
Measure by its ability to induce IL-8 secretion in HepG2 cells. The ED50 for this effect is <1.5 ng/mL. Purity:
>98% as determined by SDS-PAGE. Ni-NTA chromatography

Formulation:
The protein was lyophilized from a solution containing 1X PBS, pH 7.4.

Reconstitution:
It is recommended to reconstitute the lyophilized protein in sterile H2O to a concentration not less than 100 μg/mL and incubate the stock solution for at least 20 min to ensure sufficient re-dissolved.

Storage:
Lyophilized protein should be stored at -20°C. Upon reconstitution, protein aliquots should be stored at -20°C or -80°C.

Note:
Please use within one month after protein reconstitution.